PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G09170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 382aa    MW: 40776.2 Da    PI: 9.4521
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G09170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.66.5e-14303353555
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ Nk+L  +  e+ ++
  LPERR09G09170.1 303 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNKELERKQAEIMEM 353
                      79************************************9998777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-11299364IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76301352IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-10303351No hitNo description
PfamPF001709.4E-12303354IPR004827Basic-leucine zipper domain
CDDcd147074.41E-24303355No hitNo description
Gene3DG3DSA:1.20.5.1702.1E-13303352No hitNo description
PROSITE patternPS000360306321IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MLTDRWGGRR REEAMEFKNG GSSSDRRPPA AEGATLARQG SVYSLTFDEF QSALAGGGGV  60
GGGGGSGFGK DFSSMNMDEL LRSIWTAEES QAMASASGSA SGLGMAMGAP PPATSLQRQG  120
SLTLPRTLSA KTVDEVWRNL VRDDPPPVGA DGGGGGSEMP PHRQSTLGEM TLEEFLVRAG  180
VVRENPPAPL PPMPPQMPPQ PVPVAPKTTA FLGNFPGAND AAAASLGFAP IGIGDPVLGN  240
GLMPRAVGLP GGALAMQTAV NQFDSGDKGN SDLSSPTEPM PYSFEGLVRG RRNGGGVEKV  300
VERRQRRMIK NRESAARSRA RKQAYTMELE AEVQKLKELN KELERKQAEI MEMQKNEVEE  360
MIKDPFGRRK RVCLRRTLTG PW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612550.10.0PREDICTED: bZIP transcription factor TRAB1-like
SwissprotQ6ZDF31e-105TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A0D9XEG60.0A0A0D9XEG6_9ORYZ; Uncharacterized protein
STRINGOB09G19140.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.23e-38ABRE binding factor 4